General Information

  • ID:  hor004706
  • Uniprot ID:  Q6DUW8(28-111)
  • Protein name:  Protein IDA-LIKE 5
  • Gene name:  IDL5
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  NA
  • Source:  Plant
  • Expression:  Expressed mainly in flowers. Lower levels in buds and seedlings. Detected in vascular tissues and in hydathodes.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0010227 floral organ abscission
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DSLRRYSSSSRPQRFFKVRRPNPRNHHHQNQGFNGDDYPPESFSGFLPKTLPIPHSAPSRKHNVYGLQRTNSRSSYFWTHAHLS
  • Length:  84(28-111)
  • Propeptide:  MGNKRIKAMMILVVMIMMVFSWRICEADSLRRYSSSSRPQRFFKVRRPNPRNHHHQNQGFNGDDYPPESFSGFLPKTLPIPHSAPSRKHNVYGLQRTNSRSSYFWTHAHLS
  • Signal peptide:  MGNKRIKAMMILVVMIMMVFSWRICEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in floral abscission.
  • Mechanism:  IDL5 is only partially redundant with IDA.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DUW8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004706_AF2.pdbhor004706_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1135540 Formula: C438H652N142O123
Absent amino acids: CM Common amino acids: S
pI: 11.72 Basic residues: 20
Polar residues: 30 Hydrophobic residues: 17
Hydrophobicity: -131.43 Boman Index: -28072
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 37.14
Instability Index: 6715.6 Extinction Coefficient cystines: 11460
Absorbance 280nm: 138.07

Literature

  • PubMed ID:  12972671
  • Title:  Inflorescence deficient in abscission controls floral organ abscission in Arabidopsis and identifies a novel family of putative ligands in plants.
  • PubMed ID:  18660431
  • Title:   The EPIP peptide of INFLORESCENCE DEFICIENT IN ABSCISSION is sufficient to induce abscission in arabidopsi